In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

Calicin (CCIN) Antikörper

Antigen

Calicin (CCIN)

Synonyme CCIN, MGC133688, Ccin, MGC94933, 4933417A14Rik
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN631496
Menge 50 ug  (1 mg/ml)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung Calicin
Immunogen Calicin antibody was raised using the C terminal of CCIN corresponding to a region with amino acids TTSVPVLPNSCPLDVSHAICSIGDSKVFVCGGVTTASDVQTKDYTINPNA
Beschreibung CCIN is a basic protein of the sperm head cytoskeleton. This protein contains kelch repeats and a BTB/POZ domain and is necessary for normal morphology during sperm differentiation.
Molekulargewicht 65 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCIN antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Forschungsgebiet Reproduktion, Zytoskelett, Mikrofilamente
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen

Alternativen zu Antigen "Calicin (CCIN)", Typ "Antikörper" finden
Wirte Kaninchen (2), Meerschweinchen (1)
Reaktivitäten Human (3), Rind (Kuh) (2), Hund (1), Maus (1), Ratte (Rattus) (1)
Applikationen Western Blot (WB) (3), Immunhistochemie (Gefrierschnitte) (IHC (fro)) (1)
Epitope N-Term (1)