Hydroxyacid Oxidase 2 (HAO2) Antikörper

Produktnummer ABIN631486

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch Hydroxyacid Oxidase 2 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für Hydroxyacid Oxidase 2 (HAO2) Antikörper (ABIN631486)

Target: Hydroxyacid Oxidase 2 (HAO2)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails

Aufreinigung: Affinity purified

Immunogen: HAO2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEISAPICIAPTGFHCLVW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HAO2 Blocking Peptide, (ABIN937271), is also available for use as a blocking control in assays to test for specificity of this HAO2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAO2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Hydroxyacid Oxidase 2 (HAO2)

Andere Bezeichnung: HAO2

Hintergrund: HAO2 is one of three related proteins that have 2-hydroxyacid oxidase activity yet differ in amino acid sequence, tissue expression and substrate preference. Subcellular location of the protein is the peroxisome. Specifically, the protein is expressed predominantly in liver and kidney and has the highest activity toward the substrate 2-hydroxypalmitate. Two alternatively spliced variants encoding the same isoform have been described.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process