BPGM Antikörper (Middle Region)

Produktnummer ABIN631461

Der Kaninchen Polyklonal anti-BPGM Antikörper (ABIN631461) detektiert spezifisch BPGM in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für BPGM Antikörper (Middle Region) (ABIN631461)

Target: BPGM (2,3-bisphosphoglycerate Mutase (BPGM))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BPGM Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-BPGM Antikörper

Bindungsspezifität: Middle Region

Spezifität: BPGM antibody was raised against the middle region of BPGM

Aufreinigung: Affinity purified

Immunogen: BPGM antibody was raised using the middle region of BPGM corresponding to a region with amino acids EQVRLWRRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BPGM Blocking Peptide, (ABIN938070), is also available for use as a blocking control in assays to test for specificity of this BPGM antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BPGM antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BPGM

Target: BPGM (2,3-bisphosphoglycerate Mutase (BPGM))

Andere Bezeichnung: BPGM

Hintergrund: BPGM belongs to the phosphoglycerate mutase family, BPG-dependent PGAM subfamily. It plays a major role in regulating hemoglobin oxygen affinity as a consequence of controlling 2,3-BPG concentration.

Molekulargewicht: 28 kDa (MW of target protein)