SCGN Antikörper

Antigen: SCGN

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN631460

Produktbeschreibung

Immunogen: SCGN antibody was raised using the middle region of SCGN corresponding to a region with amino acids KDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP

Beschreibung: SCGN is a secreted calcium-binding protein which is found in the cytoplasm. It is related to calbindin D-28K and calretinin. This protein is thought to be involved in KCL-stimulated calcium flux and cell proliferation.

Molekulargewicht: 32 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SCGN antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Forschungsgebiet: Neurologie

Beschränkungen: Nur für Forschungszwecke einsetzbar