SCGN Antikörper (Middle Region)

Produktnummer ABIN631459

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SCGN in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für SCGN Antikörper (Middle Region) (ABIN631459)

Target: SCGN (Secretagogin, EF-Hand Calcium Binding Protein (SCGN))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SCGN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SCGN Antikörper

Bindungsspezifität: Middle Region

Spezifität: SCGN antibody was raised against the middle region of SCGN

Aufreinigung: Affinity purified

Immunogen: SCGN antibody was raised using the middle region of SCGN corresponding to a region with amino acids LQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SCGN Blocking Peptide, (ABIN5616012), is also available for use as a blocking control in assays to test for specificity of this SCGN antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCGN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SCGN

Target: SCGN (Secretagogin, EF-Hand Calcium Binding Protein (SCGN))

Andere Bezeichnung: SCGN

Hintergrund: SCGN is a secreted calcium-binding protein which is found in the cytoplasm. It is related to calbindin D-28K and calretinin. This protein is thought to be involved in KCL-stimulated calcium flux and cell proliferation.

Molekulargewicht: 32 kDa (MW of target protein)