CDCA5 Antikörper (Middle Region)

Produktnummer ABIN631455

Der Kaninchen Polyklonal anti-CDCA5 Antikörper (ABIN631455) detektiert spezifisch CDCA5 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für CDCA5 Antikörper (Middle Region) (ABIN631455)

Target: CDCA5 (Cell Division Cycle Associated 5 (CDCA5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDCA5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CDCA5 Antikörper

Bindungsspezifität: Middle Region

Spezifität: CDCA5 antibody was raised against the middle region of CDCA5

Aufreinigung: Affinity purified

Immunogen: CDCA5 antibody was raised using the middle region of CDCA5 corresponding to a region with amino acids RRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDCA5 Blocking Peptide, (ABIN5612778), is also available for use as a blocking control in assays to test for specificity of this CDCA5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDCA5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CDCA5

Target: CDCA5 (Cell Division Cycle Associated 5 (CDCA5))

Andere Bezeichnung: CDCA5

Hintergrund: CDCA5 is the regulator of sister chromatid cohesion in mitosis. It may act by regulating the ability of the cohesin complex to mediate sister chromatid cohesion, perhaps by altering the nature of the interaction of cohesin with the chromosomes.

Molekulargewicht: 28 kDa (MW of target protein)

Pathways: Chromatin Binding