HGD Antikörper

Produktnummer ABIN631446

Der Kaninchen Polyklonal anti-HGD Antikörper (ABIN631446) detektiert spezifisch HGD in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für HGD Antikörper (ABIN631446)

Target: HGD (Homogentisate 1,2-Dioxygenase (HGD))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HGD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HGD Antikörper

Aufreinigung: Affinity purified

Immunogen: HGD antibody was raised using a synthetic peptide corresponding to a region with amino acids KLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HGD Blocking Peptide, (ABIN939893), is also available for use as a blocking control in assays to test for specificity of this HGD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HGD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HGD

Target: HGD (Homogentisate 1,2-Dioxygenase (HGD))

Andere Bezeichnung: HGD

Hintergrund: Homogentisate 1,2-dioxygenase (HGD) gene mutations are the molecular cause of alkaptonuria, a rare hereditary disorder of the phenylalanine catabolism. The highest expression of HGD is in the prostate, small intestine, colon, and liver.

Molekulargewicht: 50 kDa (MW of target protein)