Pallidin Antikörper

Produktnummer ABIN631430

Der Kaninchen Polyklonal anti-Pallidin Antikörper wird verwendet zum Nachweis von Pallidin in Proben von Human und Maus. Er wurde validiert für WB.

Kurzübersicht für Pallidin Antikörper (ABIN631430)

Target: Pallidin (PLDN) (Pallidin Homolog (PLDN))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Pallidin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Pallidin Antikörper

Aufreinigung: Affinity purified

Immunogen: PLDN antibody was raised using a synthetic peptide corresponding to a region with amino acids MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PLDN Blocking Peptide, (ABIN5615411), is also available for use as a blocking control in assays to test for specificity of this PLDN antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLDN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Pallidin

Target: Pallidin (PLDN) (Pallidin Homolog (PLDN))

Andere Bezeichnung: PLDN

Hintergrund: PLDN may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion.

Molekulargewicht: 20 kDa (MW of target protein)

Pathways: Synaptic Vesicle Exocytosis