alpha Actinin 4 Antikörper (C-Term)

Produktnummer ABIN631408

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch alpha Actinin 4 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für alpha Actinin 4 Antikörper (C-Term) (ABIN631408)

Target: alpha Actinin 4 (ACTN4) (Actinin, alpha 4 (ACTN4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser alpha Actinin 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-alpha Actinin 4 Antikörper

Bindungsspezifität: C-Term

Spezifität: Alpha Actinin 4 antibody was raised against the C terminal of ACTN4

Aufreinigung: Affinity purified

Immunogen: alpha Actinin 4 antibody was raised using the C terminal of ACTN4 corresponding to a region with amino acids DVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVI

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Alpha Actinin 4 Blocking Peptide, (ABIN937599), is also available for use as a blocking control in assays to test for specificity of this Alpha Actinin 4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTN4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu alpha Actinin 4

Target: alpha Actinin 4 (ACTN4) (Actinin, alpha 4 (ACTN4))

Andere Bezeichnung: alpha Actinin 4

Hintergrund: Alpha actinins belong to the spectrin superfamily which is a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. ACTN4 is a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Mutations in its gene have been associated with focal and segmental glomerulosclerosis.

Molekulargewicht: 105 kDa (MW of target protein)

Pathways: Proton Transport