WDSUB1 Antikörper (Middle Region)

Produktnummer ABIN631388

Der Kaninchen Polyklonal anti-WDSUB1 Antikörper wird verwendet zum Nachweis von WDSUB1 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für WDSUB1 Antikörper (Middle Region) (ABIN631388)

Target: WDSUB1 (WD Repeat, Sterile alpha Motif and U-Box Domain Containing 1 (WDSUB1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WDSUB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-WDSUB1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: WDSUB1 antibody was raised against the middle region of WDSUB1

Aufreinigung: Affinity purified

Immunogen: WDSUB1 antibody was raised using the middle region of WDSUB1 corresponding to a region with amino acids KVKSLSSGIPDEFICPITRELMKDPVIASDGYSYEKEAMENWISKKKRTS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WDSUB1 Blocking Peptide, (ABIN940097), is also available for use as a blocking control in assays to test for specificity of this WDSUB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDSUB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WDSUB1

Target: WDSUB1 (WD Repeat, Sterile alpha Motif and U-Box Domain Containing 1 (WDSUB1))

Andere Bezeichnung: WDSUB1

Hintergrund: WDSUB1 contains 1 SAM (sterile alpha motif) domain, 1 U-box domain and 7 WD repeats. The function of WDSUB1 remains unknown.

Molekulargewicht: 53 kDa (MW of target protein)