FBXW11 Antikörper (N-Term)

Produktnummer ABIN631368

Der Kaninchen Polyklonal anti-FBXW11 Antikörper (ABIN631368) detektiert spezifisch FBXW11 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human und Maus.

Kurzübersicht für FBXW11 Antikörper (N-Term) (ABIN631368)

Target: FBXW11 (F-Box and WD Repeat Domain Containing 11 (FBXW11))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBXW11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FBXW11 Antikörper

Bindungsspezifität: N-Term

Spezifität: FBXW11 antibody was raised against the N terminal of FBXW11

Aufreinigung: Affinity purified

Immunogen: FBXW11 antibody was raised using the N terminal of FBXW11 corresponding to a region with amino acids CLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBXW11 Blocking Peptide, (ABIN937130), is also available for use as a blocking control in assays to test for specificity of this FBXW11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXW11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBXW11

Target: FBXW11 (F-Box and WD Repeat Domain Containing 11 (FBXW11))

Andere Bezeichnung: FBXW11

Hintergrund: FBXW11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbws class and, in addition to an F-box, contains multiple WD40 repeats.

Molekulargewicht: 62 kDa (MW of target protein)