AHCY Antikörper (N-Term)

Produktnummer ABIN631294

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch AHCY in WB. Es zeigt Reaktivität gegenüber Proben von Human und Maus.

Kurzübersicht für AHCY Antikörper (N-Term) (ABIN631294)

Target: AHCY (Adenosylhomocysteinase (AHCY))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AHCY Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AHCY Antikörper

Bindungsspezifität: N-Term

Spezifität: AHCY antibody was raised against the N terminal of AHCY

Aufreinigung: Affinity purified

Immunogen: AHCY antibody was raised using the N terminal of AHCY corresponding to a region with amino acids SDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AHCY Blocking Peptide, (ABIN5611977), is also available for use as a blocking control in assays to test for specificity of this AHCY antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AHCY antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AHCY

Target: AHCY (Adenosylhomocysteinase (AHCY))

Andere Bezeichnung: AHCY

Hintergrund: S-adenosylhomocysteine hydrolase catalyzes the reversible hydrolysis of S-adenosylhomocysteine (AdoHcy) to adenosine (Ado) and L-homocysteine (Hcy). Thus, it regulates the intracellular S-adenosylhomocysteine (SAH) concentration thought to be important for transmethylation reactions. Deficiency in this protein is one of the different causes of hypermethioninemia.

Molekulargewicht: 48 kDa (MW of target protein)