PIP4K2A Antikörper (N-Term)

Produktnummer ABIN631281

Der Kaninchen Polyklonal anti-PIP4K2A Antikörper (ABIN631281) detektiert spezifisch PIP4K2A in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für PIP4K2A Antikörper (N-Term) (ABIN631281)

Target: PIP4K2A (Phosphatidylinositol-5-Phosphate 4-Kinase, Type II, alpha (PIP4K2A))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PIP4K2A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PIP4K2A Antikörper

Bindungsspezifität: N-Term

Spezifität: PIP4 K4 antibody was raised against the N terminal of PIP4 4

Aufreinigung: Affinity purified

Immunogen: PIP4 K4 antibody was raised using the N terminal of PIP4 4 corresponding to a region with amino acids IDDQDFQNSLTRSAPLPNDSQARSGARFHTSYDKRYIIKTITSEDVAEMH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PIP4K2A Blocking Peptide, (ABIN939295), is also available for use as a blocking control in assays to test for specificity of this PIP4K2A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIP0 0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PIP4K2A

Target: PIP4K2A (Phosphatidylinositol-5-Phosphate 4-Kinase, Type II, alpha (PIP4K2A))

Andere Bezeichnung: PIP4K2A

Hintergrund: Phosphatidylinositol-5,4-bisphosphate, the precursor to second messengers of the phosphoinositide signal transduction pathways, is thought to be involved in the regulation of secretion, cell proliferation, differentiation, and motility.

Molekulargewicht: 46 kDa (MW of target protein)

Pathways: Inositol Metabolic Process