AKAP7 Antikörper

Produktnummer ABIN631262

Der Kaninchen Polyklonal anti-AKAP7 Antikörper wird verwendet zum Nachweis von AKAP7 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für AKAP7 Antikörper (ABIN631262)

Target: AKAP7 (A Kinase (PRKA) Anchor Protein 7 (AKAP7))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AKAP7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AKAP7 Antikörper

Aufreinigung: Affinity purified

Immunogen: AKAP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLLVMQLLNEDEVNIGIDALLELKPFIEELLQGKHLTLPFQGIGTFGNQV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AKAP7 Blocking Peptide, (ABIN5611990), is also available for use as a blocking control in assays to test for specificity of this AKAP7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKAP7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AKAP7

Target: AKAP7 (A Kinase (PRKA) Anchor Protein 7 (AKAP7))

Andere Bezeichnung: AKAP7

Hintergrund: AKAP7 is a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments.

Molekulargewicht: 37 kDa (MW of target protein)