In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

Ubiquitin Associated and SH3 Domain Containing, A (UBASH3A) Antikörper

Antigen

Ubiquitin Associated and SH3 Domain Containing, A (UBASH3A)

Synonyme TULA, CLIP4, STS-2, Sts-2, C330001M22, 5830413C03Rik, UBASH3A
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN631208
Menge 50 ug  (1 mg/ml)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung UBASH3A
Immunogen UBASH3A antibody was raised using the middle region of UBASH3A corresponding to a region with amino acids PCSLPRRSRGIKDFENDPPLSSCGIFQSRIAGDALLDSGIRISSVFASPA
Beschreibung UBASH3A interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. It also promotes accumulation of activated target receptors, such as T-cell receptors, EGFR and PDGFRB, on the cell surface.
Molekulargewicht 74 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UBASH3A antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen

Alternativen zu Antigen "Ubiquitin Associated and SH3 Domain Containing, A (UBASH3A)", Typ "Antikörper" finden
Wirte Ziege (8), Kaninchen (6), Maus (4)
Reaktivitäten Human (14), Hund (3), Rind (Kuh) (1), Maus (1), Ratte (Rattus) (1)
Applikationen Western Blot (WB) (10), Enzyme Immunoassay (EIA) (7), Immunhistochemie (Paraffinschnitte) (IHC (p)) (4), ELISA (3), ELISA (Detektionsantikörper) (2), Immunfluoreszenz (IF) (1), Immunhistochemie (IHC) (1)
Epitope internal (2), N-Term (1)