AGXT2L1 Antikörper (Middle Region)

Produktnummer ABIN631174

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch AGXT2L1 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für AGXT2L1 Antikörper (Middle Region) (ABIN631174)

Target: AGXT2L1 (Alanine-Glyoxylate Aminotransferase 2-Like 1 (AGXT2L1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AGXT2L1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AGXT2L1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: AGXT2 L1 antibody was raised against the middle region of AGXT2 1

Aufreinigung: Affinity purified

Immunogen: AGXT2 L1 antibody was raised using the middle region of AGXT2 1 corresponding to a region with amino acids KRVLLSADGPHRNVLKIKPPMCFTEEDAKFMVDQLDRILTVLEEAMGTKT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AGXT2L1 Blocking Peptide, (ABIN940025), is also available for use as a blocking control in assays to test for specificity of this AGXT2L1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGXT0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AGXT2L1

Target: AGXT2L1 (Alanine-Glyoxylate Aminotransferase 2-Like 1 (AGXT2L1))

Andere Bezeichnung: AGXT2L1

Hintergrund: AGXT2L1 belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family.

Molekulargewicht: 56 kDa (MW of target protein)