PADI2 Antikörper (Middle Region)

Produktnummer ABIN631162

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch PADI2 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für PADI2 Antikörper (Middle Region) (ABIN631162)

Target: PADI2 (Peptidyl Arginine Deiminase, Type II (PADI2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PADI2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PADI2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PADI2 antibody was raised against the middle region of PADI2

Aufreinigung: Affinity purified

Immunogen: PADI2 antibody was raised using the middle region of PADI2 corresponding to a region with amino acids RGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYV

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PADI2 Blocking Peptide, (ABIN5615187), is also available for use as a blocking control in assays to test for specificity of this PADI2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PADI2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PADI2

Target: PADI2 (Peptidyl Arginine Deiminase, Type II (PADI2))

Andere Bezeichnung: PADI2

Hintergrund: PADI2 encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distinct substrate specificities and tissue-specific expression patterns. The type II enzyme is the most widely expressed family member. Known substrates for this enzyme include myelin basic protein in the central nervous system and vimentin in skeletal muscle and macrophages. PADI2 is thought to play a role in the onset and progression of neurodegenerative human disorders, including Alzheimer disease and multiple sclerosis, and it has also been implicated in glaucoma pathogenesis.

Molekulargewicht: 75 kDa (MW of target protein)