HPD Antikörper (Middle Region)

Produktnummer ABIN631126

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch HPD in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für HPD Antikörper (Middle Region) (ABIN631126)

Target: HPD (4-Hydroxyphenylpyruvate Dioxygenase (HPD))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HPD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HPD Antikörper

Bindungsspezifität: Middle Region

Spezifität: HPD antibody was raised against the middle region of HPD

Aufreinigung: Affinity purified

Immunogen: HPD antibody was raised using the middle region of HPD corresponding to a region with amino acids EMIDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HPD Blocking Peptide, (ABIN937970), is also available for use as a blocking control in assays to test for specificity of this HPD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HPD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HPD

Target: HPD (4-Hydroxyphenylpyruvate Dioxygenase (HPD))

Andere Bezeichnung: HPD

Hintergrund: The protein encoded by this gene is an enzyme in the catabolic pathway of tyrosine. The encoded protein catalyzes the conversion of 4-hydroxyphenylpyruvate to homogentisate. Defects in this gene are a cause of tyrosinemia type 3 (TYRO3) and hawkinsinuria.

Molekulargewicht: 45 kDa (MW of target protein)