PACRG Antikörper (Middle Region)

Produktnummer ABIN631123

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch PACRG in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für PACRG Antikörper (Middle Region) (ABIN631123)

Target: PACRG (PARK2 Co-Regulated (PACRG))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PACRG Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PACRG Antikörper

Bindungsspezifität: Middle Region

Spezifität: PACRG antibody was raised against the middle region of PACRG

Aufreinigung: Affinity purified

Immunogen: PACRG antibody was raised using the middle region of PACRG corresponding to a region with amino acids GAIMARCNLDHLGSSDPPTSASQVAEIIVNSGDGIDYSQQKRENIGDLIQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PACRG Blocking Peptide, (ABIN938543), is also available for use as a blocking control in assays to test for specificity of this PACRG antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PACRG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PACRG

Target: PACRG (PARK2 Co-Regulated (PACRG))

Andere Bezeichnung: PACRG

Hintergrund: PACRG is a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. These genes are co-regulated in various tissues and they share a bi-directional promoter. Both genes are associated with susceptibility to leprosy.

Molekulargewicht: 33 kDa (MW of target protein)