NDUFC1 Antikörper

Produktnummer ABIN631080

Der Kaninchen Polyklonal anti-NDUFC1 Antikörper (ABIN631080) detektiert spezifisch NDUFC1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für NDUFC1 Antikörper (ABIN631080)

Target: NDUFC1 (NADH Dehydrogenase (Ubiquinone) 1, Subcomplex Unknown, 1, 6kDa (NDUFC1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NDUFC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NDUFC1 Antikörper

Aufreinigung: Affinity purified

Immunogen: NDUFC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRRNGL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NDUFC1 Blocking Peptide, (ABIN5614943), is also available for use as a blocking control in assays to test for specificity of this NDUFC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NDUFC1

Target: NDUFC1 (NADH Dehydrogenase (Ubiquinone) 1, Subcomplex Unknown, 1, 6kDa (NDUFC1))

Andere Bezeichnung: NDUFC1

Hintergrund: NDUFC1 is the accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain.

Molekulargewicht: 9 kDa (MW of target protein)