AIFM3 Antikörper (Middle Region)

Produktnummer ABIN631043

Der Kaninchen Polyklonal anti-AIFM3 Antikörper wird verwendet zum Nachweis von AIFM3 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für AIFM3 Antikörper (Middle Region) (ABIN631043)

Target: AIFM3 (Apoptosis-Inducing Factor, Mitochondrion-Associated, 3 (AIFM3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AIFM3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AIFM3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: AIFM3 antibody was raised against the middle region of AIFM3

Aufreinigung: Affinity purified

Immunogen: AIFM3 antibody was raised using the middle region of AIFM3 corresponding to a region with amino acids EGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AIFM3 Blocking Peptide, (ABIN937815), is also available for use as a blocking control in assays to test for specificity of this AIFM3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AIFM3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AIFM3

Target: AIFM3 (Apoptosis-Inducing Factor, Mitochondrion-Associated, 3 (AIFM3))

Andere Bezeichnung: AIFM3

Hintergrund: AIFM3 induces apoptosis through a caspase dependent pathway. AIFM3 reduces mitochondrial membrane potential.

Molekulargewicht: 67 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity, Cell RedoxHomeostasis