Acetyl-CoA Acetyltransferase 1 (ACAT1) Antikörper

Antigen: Acetyl-CoA Acetyltransferase 1 (ACAT1)

Synonyme: T2, MAT, ACAT, THIL, SOAT, STAT, ACACT, ACAT1, RP11-215I23.2, ald, Acact, ACAT-1, AW550831, 8430426K15Rik, RATACAL, Acat-1, Acat, 6330585C21Rik, fd16h07, fd20g06, zgc:86832, wu:fd16h07, wu:fd20g06, MGC137917, MGC107795, acat1, CEH, TGH, CES2, HMSE, SES1, HMSE1, PCE-1, MGC117365, Es2, MGC109055, LOC100009551

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN631042

Produktbeschreibung

Weitere Bezeichnung: ACAT1

Immunogen: ACAT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKL

Beschreibung: ACAT1 is a mitochondrially localized enzyme that catalyzes the reversible formation of acetoacetyl-CoA from two molecules of acetyl-CoA. The gene encoding ACAT1 spans approximately 27 kb and contains 12 exons interrupted by 11 introns. Defects in this gene are associated with the alpha-methylacetoaceticaciduria disorder, an inborn error of isoleucine catabolism characterized by urinary excretion of 2-methyl-3-hydroxybutyric acid, 2-methylacetoacetic acid, tiglylglycine, and butanone.

Molekulargewicht: 41 kDa (MW of target protein)

Synonyme: T2, MAT, ACAT, THIL, SOAT, STAT, ACACT, ACAT1, RP11-215I23.2, ald, Acact, ACAT-1, AW550831, 8430426K15Rik, RATACAL, Acat-1, Acat, 6330585C21Rik, fd16h07, fd20g06, zgc:86832, wu:fd16h07, wu:fd20g06, MGC137917, MGC107795, acat1, CEH, TGH, CES2, HMSE, SES1, HMSE1, PCE-1, MGC117365, Es2, MGC109055, LOC100009551

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACAT1 antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Forschungsgebiet: Krebs, Metabolismus, Organelle

Beschränkungen: Nur für Forschungszwecke einsetzbar