In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

Tryptophanyl tRNA Synthetase 2, Mitochondrial (WARS2) Antikörper

Antigen

Tryptophanyl tRNA Synthetase 2, Mitochondrial (WARS2)

Synonyme TrpRS, zgc:110828, MGC127444
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN630987
Menge 50 ug  (1 mg/ml)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung WARS2
Immunogen WARS2 antibody was raised using the middle region of WARS2 corresponding to a region with amino acids TTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQG
Beschreibung Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. WARS2 is the mitochondrial tryptophanyl-tRNA synthetase.
Molekulargewicht 24 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WARS2 antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen

Alternativen zu Antigen "Tryptophanyl tRNA Synthetase 2, Mitochondrial (WARS2)", Typ "Antikörper" finden
Wirte Kaninchen (5), Maus (2)
Reaktivitäten Human (7), Huhn (1), Rind (Kuh) (1), Hund (1), Maus (1), Schwein (1), Ratte (Rattus) (1)
Applikationen Western Blot (WB) (6), Enzyme Immunoassay (EIA) (3), ELISA (2), ELISA (Detektionsantikörper) (1), Immunhistochemie (IHC) (1), Immunhistochemie (Paraffinschnitte) (IHC (p)) (1)
Epitope C-Term (2)