WW Domain Binding Protein 11 (WBP11) Antikörper

Antigen: WW Domain Binding Protein 11 (WBP11)

Synonyme: Npwbp, SIPP1, D6Wsu113e, 2510026P17Rik, MGC94547, MGC81512, MGC69268, SNP70, DKFZp459K0128, DKFZp468G2320, DKFZp468M0325

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN630981

Produktbeschreibung

Weitere Bezeichnung: WBP11

Immunogen: WBP11 antibody was raised using the N terminal of WBP11 corresponding to a region with amino acids GRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPK

Beschreibung: WBP11 is a nuclear protein, which colocalizes with mRNA splicing factors and intermediate filament-containing perinuclear networks. WBP11has 95% amino acid sequence identity to the mouse Wbp11 protein. It contains two proline-rich regions that bind to the WW domain of Npw38, a nuclear protein, and thus this protein is also called Npw38-binding protein NpwBP. The Npw38-NpwBP complex may function as a component of an mRNA factory in the nucleus.

Molekulargewicht: 70 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WBP11 antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Beschränkungen: Nur für Forschungszwecke einsetzbar