GAMT Antikörper (Middle Region)

Produktnummer ABIN630904

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch GAMT in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für GAMT Antikörper (Middle Region) (ABIN630904)

Target: GAMT (Guanidinoacetate N-Methyltransferase (GAMT))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GAMT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GAMT Antikörper

Bindungsspezifität: Middle Region

Spezifität: GAMT antibody was raised against the middle region of GAMT

Aufreinigung: Affinity purified

Immunogen: GAMT antibody was raised using the middle region of GAMT corresponding to a region with amino acids PGEGPFLTPWVGWTVLVHLEIKVLCLAQWLPGAVAQVYNPSTVEGRGGQI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GAMT Blocking Peptide, (ABIN5613723), is also available for use as a blocking control in assays to test for specificity of this GAMT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAMT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GAMT

Target: GAMT (Guanidinoacetate N-Methyltransferase (GAMT))

Andere Bezeichnung: GAMT

Hintergrund: GAMT is a methyltransferase that converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl donor. Defects in its gene have been implicated in neurologic syndromes and muscular hypotonia.

Molekulargewicht: 29 kDa (MW of target protein)