SCO Cytochrome Oxidase Deficient Homolog 1 (Yeast) (SCO1) Antikörper

Antigen: SCO Cytochrome Oxidase Deficient Homolog 1 (Yeast) (SCO1)

Synonyme: SCOD1, D11Bwg1310e, 2610001C07Rik, SCO1, RGD1559538, MGC143363

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN630894

Produktbeschreibung

Weitere Bezeichnung: SCO1

Immunogen: SCO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYL

Beschreibung: Mammalian cytochrome c oxidase (COX) catalyzes the transfer of reducing equivalents from cytochrome c to molecular oxygen and pumps protons across the inner mitochondrial membrane.

Molekulargewicht: 34 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SCO1 antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Forschungsgebiet: Signaltransduktion, Metabolismus, Organelle

Beschränkungen: Nur für Forschungszwecke einsetzbar