phosphodiesterase 4B, CAMP-Specific (PDE4B) Antikörper

Antigen: phosphodiesterase 4B, CAMP-Specific (PDE4B)

Synonyme: DPDE4, PDE4B5, PDEIVB, MGC126529, DKFZp686F2182, MGC83972, MGC147384

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN630858

Produktbeschreibung

Weitere Bezeichnung: PDE4B

Immunogen: PDE4B antibody was raised using a synthetic peptide corresponding to a region with amino acids QDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEED

Beschreibung: This gene is a member of the type IV, cyclic AMP (cAMP)-specific, cyclic nucleotide phosphodiesterase (PDE) family. Cyclic nucleotides are important second messengers that regulate and mediate a number of cellular responses to extracellular signals, such as hormones, light, and neurotransmitters. The cyclic nucleotide phosphodiesterases (PDEs) regulate the cellular concentrations of cyclic nucleotides and thereby play a role in signal transduction.

Molekulargewicht: 64 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDE4B antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Forschungsgebiet: Signaltransduktion, Enzyme, Metabolismus

Beschränkungen: Nur für Forschungszwecke einsetzbar