In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

Heat Shock 70kDa Protein 4 (HSPA4) Antikörper

Antigen

Heat Shock 70kDa Protein 4 (HSPA4)

Synonyme DKFZp459F0933
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN630854
Menge 50 ug  (1 mg/ml)  (Varianten)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung HSPA4
Immunogen HSPA4 antibody was raised using the middle region of HSPA4 corresponding to a region with amino acids PIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTK
Beschreibung HSPA4(Hsp70) belongs to the heat shock protein 70 family. It was isolated as a putative Rictor interacting protein and interaction with membranes acts as a platform for its release into the extracellular environment during its recovery from stress. Hsp70 gene expression in Rheumatoid Arthitis-affected synovial tissue is followed by Hsp70 cell surface expression on fibroblast-like synovial cells growing from RA synovial tissue. Serum Hsp70 levels were increased in Systemic sclerosis patients, and associated with pulmonary fibrosis, skin sclerosis, renal vascular damage, oxidative stress, and inflammation.
Molekulargewicht 94 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HSPA4 antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Forschungsgebiet Hitzeschockproteine
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen

Alternativen zu Antigen "Heat Shock 70kDa Protein 4 (HSPA4)", Typ "Antikörper" finden
Wirte Kaninchen (11), Maus (6)
Reaktivitäten Human (9), Rind (Kuh) (4), Huhn (2), Hund (2), Maus (2), Ratte (Rattus) (2), Schwein (1)
Applikationen Western Blot (WB) (16), Immunfluoreszenz (IF) (4), Immunhistochemie (Paraffinschnitte) (IHC (p)) (4), Immunhistochemie (Gefrierschnitte) (IHC (fro)) (3), ELISA (Detektionsantikörper) (2), Enzyme Immunoassay (EIA) (2), Immunpräzipitation (IP) (2), ELISA (1), Durchflusszytometrie (FACS) (1)