PHLDA1 Antikörper (Middle Region)

Produktnummer ABIN630749

Der Kaninchen Polyklonal anti-PHLDA1 Antikörper wird verwendet zum Nachweis von PHLDA1 in Proben von Human und Maus. Er wurde validiert für WB.

Kurzübersicht für PHLDA1 Antikörper (Middle Region) (ABIN630749)

Target: PHLDA1 (Pleckstrin Homology-Like Domain, Family A, Member 1 (PHLDA1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PHLDA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PHLDA1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PHLDA1 antibody was raised against the middle region of PHLDA1

Aufreinigung: Affinity purified

Immunogen: PHLDA1 antibody was raised using the middle region of PHLDA1 corresponding to a region with amino acids PAVASLEPPVKLKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PHLDA1 Blocking Peptide, (ABIN5615350), is also available for use as a blocking control in assays to test for specificity of this PHLDA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHLDA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PHLDA1

Target: PHLDA1 (Pleckstrin Homology-Like Domain, Family A, Member 1 (PHLDA1))

Andere Bezeichnung: PHLDA1

Hintergrund: PHLDA1 is an evolutionarily conserved proline-histidine rich nuclear protein. It may play an important role in the anti-apoptotic effects of insulin-like growth factor-1.

Molekulargewicht: 45 kDa (MW of target protein)