POLR3A Antikörper (Middle Region)

Produktnummer ABIN630732

Der Kaninchen Polyklonal anti-POLR3A Antikörper (ABIN630732) detektiert spezifisch POLR3A in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für POLR3A Antikörper (Middle Region) (ABIN630732)

Target: POLR3A (Polymerase (RNA) III (DNA Directed) Polypeptide A, 155kDa (POLR3A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser POLR3A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-POLR3A Antikörper

Bindungsspezifität: Middle Region

Spezifität: POLR3 A antibody was raised against the middle region of POLR3

Aufreinigung: Affinity purified

Immunogen: POLR3 A antibody was raised using the middle region of POLR3 corresponding to a region with amino acids AYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFDT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

POLR3A Blocking Peptide, (ABIN937013), is also available for use as a blocking control in assays to test for specificity of this POLR3A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu POLR3A

Target: POLR3A (Polymerase (RNA) III (DNA Directed) Polypeptide A, 155kDa (POLR3A))

Andere Bezeichnung: POLR3A

Hintergrund: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3A is the largest and catalytic core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. It forms the polymerase active center together with the second largest subunit. A single stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol III. A bridging helix emanates from RPC1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol III by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition.

Molekulargewicht: 156 kDa (MW of target protein)