EEF1B2 Antikörper (Middle Region)

Produktnummer ABIN630716

Der Kaninchen Polyklonal anti-EEF1B2 Antikörper wird verwendet zum Nachweis von EEF1B2 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für EEF1B2 Antikörper (Middle Region) (ABIN630716)

Target: EEF1B2 (Eukaryotic Translation Elongation Factor 1 beta 2 (EEF1B2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EEF1B2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EEF1B2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: EEF1 B2 antibody was raised against the middle region of EEF1 2

Aufreinigung: Affinity purified

Immunogen: EEF1 B2 antibody was raised using the middle region of EEF1 2 corresponding to a region with amino acids VKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EEF1B2 Blocking Peptide, (ABIN5613307), is also available for use as a blocking control in assays to test for specificity of this EEF1B2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EEF0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EEF1B2

Target: EEF1B2 (Eukaryotic Translation Elongation Factor 1 beta 2 (EEF1B2))

Andere Bezeichnung: EEF1B2

Hintergrund: EEF1B2 is a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR.

Molekulargewicht: 25 kDa (MW of target protein)