In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

Integrin beta 1 Binding Protein 3 (ITGB1BP3) Antikörper

Antigen

Integrin beta 1 Binding Protein 3 (ITGB1BP3)
Synonyme MIBP, NRK2, MGC126624, MGC78998, MGC79789, MGC128315
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen
Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN630714
Menge 50 ug  (1 mg/ml)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung
Anwendungen Alternativen Sekundärantikörper zurück nach oben

Weitere Bezeichnung ITGB1BP3
Immunogen ITGB1BP3 antibody was raised using the middle region of ITGB1BP3 corresponding to a region with amino acids YKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPDPPGLFDGHVWPMYQKY
Beschreibung ITGB1BP3 catalyzes the phosphorylation of nicotinamide riboside (NR) and nicotinic acid riboside (NaR) to form nicotinamide mononucleotide (NMN) and nicotinic acid mononucleotide (NaMN).
Molekulargewicht 26 kDa (MW of target protein)

Anwendungen
Alternativen Sekundärantikörper zurück nach oben

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ITGB1BP3 antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Forschungsgebiet Signaltransduktion, Extrazelluläre Matrix, DNS/RNS
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen
Anwendungen Sekundärantikörper zurück nach oben

Alternativen zu Antigen "Integrin beta 1 Binding Protein 3 (ITGB1BP3)", Typ "Antikörper" finden
Wirte Kaninchen (4), Maus (2)
Reaktivitäten Human (6), Maus (1), Ratte (Rattus) (1)
Applikationen Western Blot (WB) (5), ELISA (Detektionsantikörper) (2), Enzyme Immunoassay (EIA) (2), ELISA (1), Immunhistochemie (IHC) (1), Immunhistochemie (Paraffinschnitte) (IHC (p)) (1)
Epitope N-Term (2)