PIN4 Antikörper (Middle Region)

Produktnummer ABIN630680

Der Kaninchen Polyklonal anti-PIN4 Antikörper wird verwendet zum Nachweis von PIN4 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für PIN4 Antikörper (Middle Region) (ABIN630680)

Target: PIN4 (Peptidyl Prolyl Cis/Trans Isomerase NIMA Interacting 4 Protein (PIN4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PIN4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PIN4 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PIN4 antibody was raised against the middle region of PIN4

Aufreinigung: Affinity purified

Immunogen: PIN4 antibody was raised using the middle region of PIN4 corresponding to a region with amino acids LGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PIN4 Blocking Peptide, (ABIN940388), is also available for use as a blocking control in assays to test for specificity of this PIN4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIN4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PIN4

Target: PIN4 (Peptidyl Prolyl Cis/Trans Isomerase NIMA Interacting 4 Protein (PIN4))

Andere Bezeichnung: PIN4

Hintergrund: This gene encodes a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. The encoded protein catalyzes the isomerization of peptidylprolyl bonds, and may play a role in the cell cycle and chromatin remodeling.

Molekulargewicht: 16 kDa (MW of target protein)