PDSS2 Antikörper

Produktnummer ABIN630585

Der Kaninchen Polyklonal anti-PDSS2 Antikörper (ABIN630585) detektiert spezifisch PDSS2 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für PDSS2 Antikörper (ABIN630585)

Target: PDSS2 (Prenyl (Decaprenyl) Diphosphate Synthase, Subunit 2 (PDSS2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDSS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PDSS2 Antikörper

Aufreinigung: Affinity purified

Immunogen: PDSS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IKAGKGVTSAIDLCRYHGNKALEALESFPPSEARSALENIVFAVTRFS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDSS2 Blocking Peptide, (ABIN939396), is also available for use as a blocking control in assays to test for specificity of this PDSS2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDSS2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDSS2

Target: PDSS2 (Prenyl (Decaprenyl) Diphosphate Synthase, Subunit 2 (PDSS2))

Andere Bezeichnung: PDSS2

Hintergrund: The isoprenoid chain of ubiquinone (coenzyme Q) varies in length between species and is determined by trans-polyprenyl diphosphate synthase. Humans possess a heterotetrameric decaprenyl diphosphate synthase composed of DPS1 and DLP1 (PDSS2) that produces Q10 ubiquinone.

Molekulargewicht: 44 kDa (MW of target protein)