SAMSN1 Antikörper (Middle Region)

Produktnummer ABIN630534

Der Kaninchen Polyklonal anti-SAMSN1 Antikörper (ABIN630534) detektiert spezifisch SAMSN1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für SAMSN1 Antikörper (Middle Region) (ABIN630534)

Target: SAMSN1 (SAM Domain, SH3 Domain and Nuclear Localization Signals, 1 (SAMSN1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SAMSN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SAMSN1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SAMSN1 antibody was raised against the middle region of SAMSN1

Aufreinigung: Affinity purified

Immunogen: SAMSN1 antibody was raised using the middle region of SAMSN1 corresponding to a region with amino acids DISLNKSQLDDCPRDSGCYISSGNSDNGKEDLESENLSDMVHKIIITEPS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SAMSN1 Blocking Peptide, (ABIN937393), is also available for use as a blocking control in assays to test for specificity of this SAMSN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAMSN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SAMSN1

Target: SAMSN1 (SAM Domain, SH3 Domain and Nuclear Localization Signals, 1 (SAMSN1))

Andere Bezeichnung: SAMSN1

Hintergrund: SAMSN1 is a member of a novel protein family of putative adaptors and scaffold proteins containing SH3 and SAM (sterile alpha motif) domains.

Molekulargewicht: 42 kDa (MW of target protein)