In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

HBS1-Like (S. Cerevisiae) (HBS1L) Antikörper

Antigen

HBS1-Like (S. Cerevisiae) (HBS1L)

Synonyme ERFS, HBS1, EF-1a, HSPC276, DKFZp686L13262, eRFS, AI326327, 2810035F15Rik, zgc:55400, wu:fc23c07, MGC137542, DKFZp459A1713
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN630516
Menge 50 ug  (1 mg/ml)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung HBS1L
Immunogen HBS1L antibody was raised using a synthetic peptide corresponding to a region with amino acids MNHKILVCFADQGSGFCITGKIEAGYIQTGDRLLAMPPNETCTVKGITLH
Beschreibung HBS1L belongs to the GTP-binding elongation factor family. The HBS1L-MYB intergenic region on chromosome 6q23.3 influences erythrocyte, platelet, and monocyte counts. HBS1L-related genetic variants play a key role in control of fetal hemoglobin levels.
Molekulargewicht 22 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HBS1L antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Forschungsgebiet Stammzellen, Hämopoetische Vorläufer
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen

Alternativen zu Antigen "HBS1-Like (S. Cerevisiae) (HBS1L)", Typ "Antikörper" finden
Wirte Kaninchen (3), Maus (1)
Reaktivitäten Human (4), Huhn (1), Rind (Kuh) (1), Hund (1), Maus (1), Ratte (Rattus) (1)
Applikationen Western Blot (WB) (4), ELISA (Detektionsantikörper) (2), ELISA (1)