In den Warenkorb
Bestellen Sie auch über:
 |
+49 (0)241 95 163 153 |
 |
+49 (0)241 95 163 155 |
Mannose-6-Phosphate Receptor (Cation Dependent) (M6PR) Antikörper
| Antigen | Mannose-6-Phosphate Receptor (Cation Dependent) (M6PR) |
| Synonyme | SMPR, MPR46, CD-MPR, FLJ32994, CD222, CI-MPR, Mpr300, AI661837, M6P/IGF2R, M6PR, CDMPR, MGC140730, MGC94300, m6pr, MGC68896, MGC130765, zgc:77757, wu:fj81h11, MGC89423, mprd |
| Klonalität | Polyklonal |
| Wirt |
 Alternativen Kaninchen |
| Applikation |
Alternativen Western Blot (WB)
|
| Produktnummer | ABIN630460 |
| Menge | 100 ug (1 mg/ml) |
| Preis | 376,65 € Zzgl. Versandkosten €20,00 und MWSt |
| Lieferung nach |
|
| Verfügbarkeit | Lieferung in 5 bis 7 Werktagen |
Produktbeschreibung
| Weitere Bezeichnung | M6PR |
| Immunogen | M6PR antibody was raised using a synthetic peptide corresponding to a region with amino acids RLKPLFNKSFESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKE |
| Beschreibung | M6PR is a receptor for mannose-6-phosphate groups on lysosomal enzymes. The receptor forms a homodimer or homotetramer for intracellular targeting of lysosomal enzymes and export of newly synthesized lysosomal enzymes into the cell secretions. The receptor is an integral membrane protein which localizes to the trans-Golgi reticulum, endosomes, and the plasma membrane. |
| Molekulargewicht | 28 kDa (MW of target protein) |
Anwendungen
| Konzentration | 1 mg/ml |
| Reinigung | Total IgG Protein A purified |
| Buffer | Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of M6PR antibody in PBS |
| Lagerung | Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles. |
| Beschränkungen | Nur für Forschungszwecke einsetzbar |
Alternativen
Alternativen zu Antigen "Mannose-6-Phosphate Receptor (Cation Dependent) (M6PR)", Typ "Antikörper" finden
| Wirte | Kaninchen (9), Ziege (4), Schaf (3), Huhn (2), Maus (2) |
| Reaktivitäten | Human (11), Maus (4), Ratte (Rattus) (4), Rind (Kuh) (3), Hund (2) |
| Applikationen | Western Blot (WB) (15), Immunhistochemie (IHC) (8), Enzyme Immunoassay (EIA) (4), ELISA (3), Immunhistochemie (Gefrierschnitte) (IHC (fro)) (2), Dot Blot (Dot) (1), Immunfluoreszenz (IF) (1), Immunhistochemie (Paraffinschnitte) (IHC (p)) (1), Immunpräzipitation (IP) (1) |
| Epitope | internal (5), N-Term (2) |
