ADAM Metallopeptidase Domain 30 (ADAM30) Antikörper

Antigen: ADAM Metallopeptidase Domain 30 (ADAM30)

Synonyme: svph4, MGC132801, MGC132802, 4933424D07Rik

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN630427

Produktbeschreibung

Weitere Bezeichnung: ADAM30

Immunogen: ADAM30 antibody was raised using the N terminal of ADAM30 corresponding to a region with amino acids RLLLPRHLRVFSFTEHGELLEDHPYIPKDCNYMGSVKESLDSKATISTCM

Beschreibung: ADAM30 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM30 gene is testis-specific and contains a polymorphic region, resulting in isoforms with varying numbers of C-terminal repeats.

Molekulargewicht: 66 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Total IgG Protein A purified

Buffer: Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ADAM30 antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Forschungsgebiet: Proteolyse / Ubiquitin, Metalloprotease, Extrazelluläre Matrix

Beschränkungen: Nur für Forschungszwecke einsetzbar