N-Acetyltransferase 2 (Arylamine N-Acetyltransferase) (NAT2) Antikörper

Antigen: N-Acetyltransferase 2 (Arylamine N-Acetyltransferase) (NAT2)

Synonyme: AAC2, PNAT, NAT-2

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN630377

Produktbeschreibung

Weitere Bezeichnung: NAT2

Immunogen: NAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIE

Beschreibung: NAT2 is a N-acetyltransferase 2 (arylamine N-acetyltransferase 2). This enzyme functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in its gene are reponsible for the N-acetylation polymorphism in which human populations segregate into rapid,intermediate, and slow acetylator phenotypes. Polymorphisms in NAT2 are also associated with higher incidences of cancer and drug toxicity.

Molekulargewicht: 32 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Total IgG Protein A purified

Buffer: Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NAT2 antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Forschungsgebiet: Signaltransduktion, Metabolismus

Beschränkungen: Nur für Forschungszwecke einsetzbar