Solute Carrier Organic Anion Transporter Family, Member 6A1 (SLCO6A1) Antikörper

Antigen: Solute Carrier Organic Anion Transporter Family, Member 6A1 (SLCO6A1)

Synonyme: GST, CT48, OATPY, OATP6A1, MGC26949, SLCO6A1

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN630373

Produktbeschreibung

Weitere Bezeichnung: SLCO6A1

Immunogen: SLCO6A1 antibody was raised using the C terminal of SLCO6A1 corresponding to a region with amino acids LAMTRVVPDKLRSLALGVSYVILRIFGTIPGPSIFKMSGETSCILRDVNK

Beschreibung: SLCO6A1 is involved in transporter activity (solute carrier).

Molekulargewicht: 79 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Total IgG Protein A purified

Buffer: Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLCO6A1 antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Forschungsgebiet: Signaltransduktion, Metabolismus

Beschränkungen: Nur für Forschungszwecke einsetzbar