SLCO6A1 Antikörper (N-Term)

Produktnummer ABIN630372

Der Kaninchen Polyklonal anti-SLCO6A1 Antikörper (ABIN630372) detektiert spezifisch SLCO6A1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für SLCO6A1 Antikörper (N-Term) (ABIN630372)

Target: SLCO6A1 (Solute Carrier Organic Anion Transporter Family, Member 6A1 (SLCO6A1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLCO6A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLCO6A1 Antikörper

Bindungsspezifität: N-Term

Spezifität: SLCO6 A1 antibody was raised against the N terminal of SLCO6 1

Aufreinigung: Purified

Immunogen: SLCO6 A1 antibody was raised using the N terminal of SLCO6 1 corresponding to a region with amino acids CCNNIRCFMIFYCILLICQGVVFGLIDVSIGDFQKEYQLKTIEKLALEKS

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLCO6A1 Blocking Peptide, (ABIN937039), is also available for use as a blocking control in assays to test for specificity of this SLCO6A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLCO0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLCO6A1

Target: SLCO6A1 (Solute Carrier Organic Anion Transporter Family, Member 6A1 (SLCO6A1))

Andere Bezeichnung: SLCO6A1

Hintergrund: SLCO6A1 is involved in transporter activity (solute carrier).

Molekulargewicht: 79 kDa (MW of target protein)