SLC26A8 Antikörper (C-Term)

Produktnummer ABIN630337

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SLC26A8 in WB und IHC. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für SLC26A8 Antikörper (C-Term) (ABIN630337)

Target: SLC26A8 (Solute Carrier Family 26 (Sulfate Transporter), Member 8 (SLC26A8))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC26A8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SLC26A8 Antikörper

Bindungsspezifität: C-Term

Spezifität: SLC26 A8 antibody was raised against the C terminal of SLC26 8

Aufreinigung: Purified

Immunogen: SLC26 A8 antibody was raised using the C terminal of SLC26 8 corresponding to a region with amino acids EPQPETEPEMEPNPKSRPRAHTFPQQRYWPMYHPSMASTQSQTQTRTWSV

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC26A8 Blocking Peptide, (ABIN938029), is also available for use as a blocking control in assays to test for specificity of this SLC26A8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC26A8

Target: SLC26A8 (Solute Carrier Family 26 (Sulfate Transporter), Member 8 (SLC26A8))

Andere Bezeichnung: SLC26A8

Hintergrund: SLC26A8 is one member of a family of sulfate/anion transporters. Family members are well conserved in their protein (aa length among species) structures yet have markedly different tissue expression patterns.

Molekulargewicht: 61 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport