SLC25A14 Antikörper

Produktnummer ABIN630323

Der Kaninchen Polyklonal anti-SLC25A14 Antikörper wird verwendet zum Nachweis von SLC25A14 in Proben von Human, Maus, Ratte und Hund. Er wurde validiert für WB.

Kurzübersicht für SLC25A14 Antikörper (ABIN630323)

Target: SLC25A14 (Solute Carrier Family 25 (Mitochondrial Carrier, Brain), Member 14 (SLC25A14))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC25A14 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC25A14 Antikörper

Aufreinigung: Purified

Immunogen: SLC25 A14 antibody was raised using a synthetic peptide corresponding to a region with amino acids SIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGV

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC25A14 Blocking Peptide, (ABIN5616210), is also available for use as a blocking control in assays to test for specificity of this SLC25A14 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 14 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC25A14

Target: SLC25A14 (Solute Carrier Family 25 (Mitochondrial Carrier, Brain), Member 14 (SLC25A14))

Andere Bezeichnung: SLC25A14

Hintergrund: Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. SLC25A14 has an N-terminal hydrophobic domain that is not present in other UCPs.

Molekulargewicht: 21 kDa (MW of target protein)

Pathways: Proton Transport