SLC22A23 Antikörper (Middle Region)

Produktnummer ABIN630315

Der Kaninchen Polyklonal anti-SLC22A23 Antikörper (ABIN630315) detektiert spezifisch SLC22A23 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für SLC22A23 Antikörper (Middle Region) (ABIN630315)

Target: SLC22A23 (Solute Carrier Family 22 (Organic Cation Transporter), Member 23 (SLC22A23))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC22A23 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC22A23 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SLC22 A23 antibody was raised against the middle region of SLC22 23

Aufreinigung: Purified

Immunogen: SLC22 A23 antibody was raised using the middle region of SLC22 23 corresponding to a region with amino acids VVLCVNSLTGYGIHHCFARSMMGHEVKVPLLENFYADYYTTASIALVSCL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC22A23 Blocking Peptide, (ABIN5616199), is also available for use as a blocking control in assays to test for specificity of this SLC22A23 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 23 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC22A23

Target: SLC22A23 (Solute Carrier Family 22 (Organic Cation Transporter), Member 23 (SLC22A23))

Andere Bezeichnung: SLC22A23

Hintergrund: SLC22A23 belongs to a large family of transmembrane proteins that function as uniporters, symporters, and antiporters to transport organic ions across cell membranes.

Molekulargewicht: 45 kDa (MW of target protein)