SLC22A2 Antikörper
Kurzübersicht für SLC22A2 Antikörper (ABIN630308)
Target
Alle SLC22A2 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Aufreinigung
- Purified
-
Immunogen
- SLC22 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHR
-
-
anti-Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2) (AA 57-89), (N-Term) antibody
SLC22A2 Reaktivität: Human WB, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB53175 unconjugated
anti-Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2) (AA 48-135) antibodySLC22A2 Reaktivität: Human WB, ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2) (AA 321-334), (Intracellular), (Loop 3) antibodySLC22A2 Reaktivität: Maus WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2) (AA 261-370) antibodySLC22A2 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 1E3 unconjugated
anti-Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2) (Middle Region) antibodySLC22A2 Reaktivität: Human, Ratte, Maus WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2) antibodySLC22A2 Reaktivität: Human, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2) (AA 236-459) antibodySLC22A2 Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2) (AA 514-541), (C-Term) antibodySLC22A2 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB39474 unconjugated
anti-Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2) (AA 44-140) antibodySLC22A2 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2) (N-Term) antibodySLC22A2 Reaktivität: Human, Maus WB Wirt: Kaninchen Polyclonal unconjugated
-
-
Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
SLC22A2 Blocking Peptide, (ABIN5616198), is also available for use as a blocking control in assays to test for specificity of this SLC22A2 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
- Avoid repeated freeze/thaw cycles.
-
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- SLC22A2 (Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2))
-
Andere Bezeichnung
- SLC22A2
-
Hintergrund
- Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. SLC22A2 is one of the three similar cation transporters. SLC22A2 contains twelve putative transmembrane domains and is a plasma integral membrane protein. It is found primarily in the kidney, where it may mediate the first step in cation reabsorption.
-
Molekulargewicht
- 62 kDa (MW of target protein)
Target
-
