In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

Occludin (OCLN) Antikörper

Antigen

Occludin (OCLN)

Synonyme Ocl, AI503564, OCLN, ocln, oclnb, tpmt, DKFZp469D234
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN630294
Menge 100 ug  (1 mg/ml)  (Varianten)
Preis 376,65 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung Occludin
Immunogen Occludin antibody was raised using the N terminal of OCLN corresponding to a region with amino acids MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPED
Beschreibung OCLN is an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction. The possibility of several alternatively spliced products has been suggested but the full nature of these products has not been described.
Molekulargewicht 59 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Total IgG Protein A purified
Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of OCLN antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen

Alternativen zu Antigen "Occludin (OCLN)", Typ "Antikörper" finden
Wirte Kaninchen (14), Maus (7)
Reaktivitäten Human (16), Ratte (Rattus) (5), Maus (3), Rind (Kuh) (2), Hund (2)
Applikationen Western Blot (WB) (19), Immunhistochemie (Paraffinschnitte) (IHC (p)) (7), Enzyme Immunoassay (EIA) (5), ELISA (Detektionsantikörper) (2), Immunhistochemie (IHC) (2), Immunfluoreszenz (IF) (1), Immunhistochemie (Gefrierschnitte) (IHC (fro)) (1)
Epitope C-Term (3)