PIK3R3 Antikörper

Produktnummer ABIN630213

Der Kaninchen Polyklonal anti-PIK3R3 Antikörper (ABIN630213) detektiert spezifisch PIK3R3 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für PIK3R3 Antikörper (ABIN630213)

Target: PIK3R3 (Phosphatidylinositol 3-kinase regulatory subunit gamma (PIK3R3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PIK3R3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PIK3R3 Antikörper

Aufreinigung: Purified

Immunogen: PIK3 R3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNE

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PIK3R3 Blocking Peptide, (ABIN938218), is also available for use as a blocking control in assays to test for specificity of this PIK3R3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIK0 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PIK3R3

Target: PIK3R3 (Phosphatidylinositol 3-kinase regulatory subunit gamma (PIK3R3))

Andere Bezeichnung: PIK3R3

Hintergrund: PIK3R3 binds to activated (phosphorylated) protein-tyrosine kinases through its SH2 domain and regulates their kinase activity. During insulin stimulation, it also binds to IRS-1.

Molekulargewicht: 54 kDa (MW of target protein)