In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

Stromal Cell Derived Factor 2 (SDF2) Antikörper

Antigen

Stromal Cell Derived Factor 2 (SDF2)

Synonyme AI853825, MGC107120
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Immunhistochemie (IHC), Western Blot (WB)
Produktnummer ABIN630142
Menge 100 ug  (1 mg/ml)  (Varianten)
Preis 376,65 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung SDF2
Immunogen SDF2 antibody was raised using the N terminal of SDF2 corresponding to a region with amino acids KLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVC
Beschreibung SDF2 is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals.
Molekulargewicht 21 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Total IgG Protein A purified
Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SDF2 antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Forschungsgebiet Signaltransduktion, Metabolismus, Aminosäuren
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen

Alternativen zu Antigen "Stromal Cell Derived Factor 2 (SDF2)", Typ "Antikörper" finden
Wirte Kaninchen (6), Maus (3)
Reaktivitäten Human (8), Rind (Kuh) (2), Maus (2), Ratte (Rattus) (2), Huhn (1), Hund (1)
Applikationen Western Blot (WB) (8), ELISA (4), Immunhistochemie (Paraffinschnitte) (IHC (p)) (3), Enzyme Immunoassay (EIA) (1), Immunhistochemie (IHC) (1)