In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

OAT Antikörper

Antigen

OAT

Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN630132
Menge 100 ug  (1 mg/ml)  (Varianten)
Preis 376,65 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Immunogen OAT antibody was raised using a synthetic peptide corresponding to a region with amino acids VRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVI
Beschreibung OAT is a key enzyme in the pathway that converts arginine and ornithine into the major excitatory and inhibitory neurotransmitters glutamate and GABA. Mutations of this enzyme cause the autosomal recessive eye disease Gyrate Atrophy.
Molekulargewicht 45 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Total IgG Protein A purified
Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of OAT antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen

Alternativen zu Antigen "OAT", Typ "Antikörper" finden
Wirte Kaninchen (8), Maus (4)
Reaktivitäten Human (14), Maus (5), Ratte (Rattus) (3), Huhn (2), Rind (Kuh) (2), Schwein (2), Fruchtfliege (Drosophila melanogaster) (1)
Applikationen Western Blot (WB) (14), ELISA (7), Immunfluoreszenz (IF) (6), Enzyme Immunoassay (EIA) (2), Immunhistochemie (IHC) (1), Immunhistochemie (Paraffinschnitte) (IHC (p)) (1)