OAT Antikörper

Produktnummer ABIN630132

Der Kaninchen Polyklonal anti-OAT Antikörper (ABIN630132) detektiert spezifisch OAT in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für OAT Antikörper (ABIN630132)

Target: OAT (Ornithine Aminotransferase (OAT))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OAT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-OAT Antikörper

Aufreinigung: Purified

Immunogen: OAT antibody was raised using a synthetic peptide corresponding to a region with amino acids VRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVI

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OAT Blocking Peptide, (ABIN5615101), is also available for use as a blocking control in assays to test for specificity of this OAT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OAT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OAT

Target: OAT (Ornithine Aminotransferase (OAT))

Hintergrund: OAT is a key enzyme in the pathway that converts arginine and ornithine into the major excitatory and inhibitory neurotransmitters glutamate and GABA. Mutations of this enzyme cause the autosomal recessive eye disease Gyrate Atrophy.

Molekulargewicht: 45 kDa (MW of target protein)