MMP1 Antikörper

Produktnummer ABIN630129

Der Kaninchen Polyklonal anti-MMP1 Antikörper (ABIN630129) detektiert spezifisch MMP1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für MMP1 Antikörper (ABIN630129)

Target: MMP1 (Matrix Metallopeptidase 1 (Interstitial Collagenase) (MMP1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MMP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MMP1 Antikörper

Aufreinigung: Purified

Immunogen: MMP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKA

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MMP1 Blocking Peptide, (ABIN936172), is also available for use as a blocking control in assays to test for specificity of this MMP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MMP1

Target: MMP1 (Matrix Metallopeptidase 1 (Interstitial Collagenase) (MMP1))

Andere Bezeichnung: MMP1

Hintergrund: Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP1 is a secreted enzyme which breaks down the interstitial collagens, types I, II, and III.

Molekulargewicht: 52 kDa (MW of target protein)